C1orf52, Rabbit, Polyclonal Antibody, Abnova™

Availablity: In stock

Catalog/Part Number: 16175370
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16175370

₦1,299,960.00

Sorry no inventory found for this brand at this time.

Description

Sequence: PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK

Catalog/Part Number: 16175370 Category:

Technical Specifications

Antigen:  C1orf52

Conjugate:   Unconjugated

Dilution:  Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.

Gene:   C1orf52

Format:   Liquid

Gene Symbols:   C1orf52

Immunogen:    Recombinant protein corresponding to amino acids of human C1orf52.

Purification Method:   Antigen affinity purification

Regulatory Status:    RUO

Primary or Secondary:   Primary

Gene ID (Entrez):    148423

Applications:    Immunohistochemistry (PFA fixed), Western Blot

Description:   Rabbit polyclonal antibody raised against recombinant C1orf52.

Formulation:   In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)

Gene Accession No.:   Q8N6N3

Gene Alias:   FLJ44982|RP11-234D19.1|gm117

Host Species:   Rabbit

Isotype:    IgG

Quantity:   100 uL

Storage Requirements:   Store at 4°C. For long term storage store at -20°C.

Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:   Polyclonal

Target Species:   Human

Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews