C1orf52, Rabbit, Polyclonal Antibody, Abnova™
Catalog/Part Number:: 16175370
₦1,299,960.00
Description
Sequence: PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK
Technical Specifications
Antigen: C1orf52
Conjugate: Unconjugated
Dilution: Immunohistochemistry
(1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be
determined by the end user.
Gene: C1orf52
Format: Liquid
Gene Symbols: C1orf52
Immunogen: Recombinant
protein corresponding to amino acids of human C1orf52.
Purification Method:
Antigen affinity purification
Regulatory Status: RUO
Primary or Secondary:
Primary
Gene ID (Entrez): 148423
Applications: Immunohistochemistry
(PFA fixed), Western Blot
Description: Rabbit
polyclonal antibody raised against recombinant C1orf52.
Formulation: In PBS,
pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Accession No.: Q8N6N3
Gene Alias: FLJ44982|RP11-234D19.1|gm117
Host Species: Rabbit
Isotype: IgG
Quantity: 100 uL
Storage Requirements:
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Monoclonal or Polyclonal:
Polyclonal
Target Species: Human
Zero(0) Reviews